Product Description
| Cat Number | GA-020 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Endogenous galanin receptor agonist |
| Modification | None |
| Purity | >95% by hplc |
| Biomarker Target | Galanin receptors |
| Sequence Three Letter Code | H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH |
| Molecular Formula | C139H210N42O43 |
| Sl Sequence | GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS |
| Solubility | Soluble to 0.50 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| References |
Schmidt et al (1991) Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide. Proc.Natl.Acad.Sci.U.S.A. 88 11435 PMID: 1722333Webling et al (2012) Galanin Receptors and Ligands. Front. Endocrinology 3 146 https://www.frontiersin.org/article/10.3389/fendo.2012.00146Volpe et al (2020) Is Galanin a Promising Therapeutic Resource for Neural and Nonneural Diseases?_x000D_
Current Drug Targets 21(9) 922 PMID: 32096740 Related areas_x000D_ All peptides >All galanin receptor modulators >All neuroscience research categories >All endocrinology research categories > |
| Note | The product is for research use only |
Share Item: