Product Title

2 x $5566

Total:$11132.00

Back to shop

Proceed to Checkout

SVG

SVG

Search Products from 10 Million+

SVG

Exendin-4 (9-39) amide

SKU: BTL-IB-P-00124 | Brand: Isca Biochemical

Quick Enquiry

Product Description

Cat Number	GH-010
Category	Peptide
Pack Size	1 mg
Description	Glucagon like peptide-1 (GLP-1) receptor antagonist
Modification	C terminal amide
Purity	>95% by HPLC
Biomarker Target	Glucagon and related receptors
Sequence Three Letter Code	H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Molecular Formula	C149H234N40O47S
Sl Sequence	DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Solubility	Soluble in dilute acid and physiological buffers
Appearance	Freeze dried solid
Storage	Store desiccated, frozen and in the dark
References	Raufman et al (1991) Exendin-3, a novel peptide from the Heloderma horridum venom, interacts with vasoactive intestinal peptide receptors and a newly described receptor on dispersed acini from guinea pig pancreas. J.Biol.Chem. 266 2897 PMID: 1704369Goke et al (1993) Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of Ins-Secr.g β-cells. J.Biol.Chem. 268 19650 PMID: 8396143Calabria et al (2012) GLP-1 receptor antagonist exendin-(9-39) elevates fasting blood glucose levels in congenital hyperinsulinism owing to inactivating mutations in the ATP-sensitive K+ channel. Diabetes 61(10) 2585 doi:10.2337/db12-0166 Related areas_x000D_ All peptides >All glucagon and related receptor modulators >All endocrinology research categories >All diabetes research categories >
Note	The product is for research use only

SVG

SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers