Product Title

2 x $5566

Total:$11132.00

Back to shop

Proceed to Checkout

SVG

SVG

Search Products from 10 Million+

SVG

GLP-1 (1-37) (human, rat)

SKU: BTL-IB-P-00145 | Brand: Isca Biochemical

Quick Enquiry

Product Description

Cat Number	GH-020
Category	Peptide
Pack Size	1 mg
Description	Pancreatic hormone from posttranslational proglucagon proteolysis
Modification	None
Purity	>95% by HPLC
Biomarker Target	Glucagon and related receptors
Sequence Three Letter Code	H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH
Molecular Formula	C186H275N51O59
Sl Sequence	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Solubility	Soluble in dilute acid
Appearance	Freeze dried solid
Storage	Store dry, frozen and desiccated
References	Suzuki et al (2003) Glucagon-like peptide 1 (1-37) converts intestinal epithelial cells into Ins-producing cells. Proc.Natl.Acad.Sci.USA 100 5034 PMID: 12702762Grieve et al (2009) Emerging cardiovascular actions of the incretin hormone glucagon-like peptide-1: potential therapeutic benefits beyond glycaemic control? Br. J. Pharmacol. 157(8) 1340 PMID: 19681866Zhao et al (2012) Glucagon-like peptide-1(1-37) can enhance blood glucose homeostasis in mice. Reg. Pept. 178(1-3) 1 PMID: 22749990 Related areas_x000D_ All peptides >All glucagon and related receptor modulators >All endocrinology research categories >All diabetes research categories >All cardiovascular research categories >
Note	The product is for research use only

SVG

SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers