Product Title

2 x $5566

Total:$11132.00

Back to shop

Proceed to Checkout

SVG

SVG

Search Products from 10 Million+

SVG

GIP (1-39)

SKU: BTL-IB-P-00139 | Brand: Isca Biochemical

Quick Enquiry

Product Description

Cat Number	GH-160
Category	Peptide
Pack Size	1 mg
Description	Endogenous truncated form of GIP
Modification	None
Purity	>95% By HPLC
Biomarker Target	Glucagon and related receptors
Sequence Three Letter Code	H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-OH
Molecular Formula	C210H316N56O61S
Sl Sequence	YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN
Solubility	Soluble to 10 mg per ml in water
Appearance	Freeze dried solid
Storage	Store dark, dry and frozen
References	Xie et al (2004) GIP1-39, a novel Insulinotropic peptide form and aspects on its mechanism of action. Regul.Peptides 121 107_x000D_ C PMID: 15256280Ji et al (2016) Neuroprotective effects of glucose-dependent insulinotropic polypeptide in Alzheimer€™s disease. Rev. Neurosci. 27(1) 61 PMID: 26351802Hansen et al (2016) N€terminally and C€terminally truncated forms of glucose€dependent insulinotropic polypeptide are high€affinity competitive antagonists of the human GIP receptor. Br. J. Pharmacol. 173 826 PMID: 26572091 Related areas_x000D_ All peptides >All glucagon and related receptor modulators >All endocrinology research categories >All diabetes research categories >
Note	The product is for research use only

SVG

SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers