Product Title

2 x $5566

Total:$11132.00

Back to shop

Proceed to Checkout

SVG

SVG

Search Products from 10 Million+

SVG

GIP-1 (3-42) (human)

SKU: BTL-IB-P-00142 | Brand: Isca Biochemical

Quick Enquiry

Product Description

Cat Number	GH-170
Category	Peptide
Pack Size	1 mg
Description	Competes with GIP for the receptor binding site
Modification	None
Purity	>95% by HPLC
Biomarker Target	Glucagon and related receptors
Sequence Three Letter Code	H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
Molecular Formula	C214H324N58O63S
Sl Sequence	EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Solubility	Soluble in dilute acid
Appearance	Freeze dried solid
Storage	Store dessicated and frozen in the dark
References	Deacon et al (2006) GIP-(3-42) does not antagonize insulinotropic effects of GIP at physiological concentrations. Am. J. Physiol. Endocrinol. Metab. 291(3) E468 PMID: 16608883Chenhui Ji et al (2015) Neuroprotective effects of glucose-dependent insulinotropic polypeptide in Alzheimer€™s disease. Rev. Neurosci. 27 1 PMID: 26351802Hansen et al (2016) N€terminally and C€terminally truncated forms of glucose€dependent insulinotropic polypeptide are high€affinity competitive antagonists of the human GIP receptor. Br. J. Pharmacol. 173 826 PMID: 26572091 Related areas_x000D_ All peptides >All glucagon and related receptor modulators >All endocrinology research categories >All diabetes research categories >
Note	The product is for research use only

SVG

SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers