Product Title

2 x $5566

Total:$11132.00

Back to shop

Proceed to Checkout

SVG

SVG

Search Products from 10 Million+

SVG

GLP-1 (7-37)

SKU: BTL-IB-P-00147 | Brand: Isca Biochemical

Quick Enquiry

Product Description

Cat Number	GL-030
Category	Peptide
Pack Size	1 mg
Description	Endogenous GLP-1 receptor agonist
Modification	None
Purity	>95% by hplc
Biomarker Target	Glucagon and related receptors
Sequence Three Letter Code	H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH
Molecular Formula	C151H228N40O47
Sl Sequence	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Solubility	Soluble to 1 mg/ml in water
Appearance	Freeze dried solid
Storage	Store dry, frozen and in the dark
References	Hargrove et al (1995) Glucose-dependent action of glucagon-like peptide-1 (7-37) in vivo during short- or long-term administration. Metabolism 44(9) 1231 PMID: 7666800Vahl (2003) Effects of GLP-1-(7-36)NH2, GLP-1-(7-37), and GLP-1- (9-36)NH2 on intravenous glucose tolerance and glucose-induced insulin secretion in healthy humans. J Clin Endocrinol Metab. 88(4) 1772 PMID: 12679472Burgmaier et al (2013) Glucagon-like peptide-1 (GLP-1) and its split products GLP-1(9-37) and GLP-1(28-37) stabilize atherosclerotic lesions in apoe»/» mice. Atherosclerosis 231(2) 427 PMID: 24267262 Related areas_x000D_ All peptides >All glucagon and related receptor modulators >All endocrinology research categories >All diabetes research categories >All cardiovascular research categories >
Note	The product is for research use only

SVG

SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers