Product Title

2 x $5566

Total:$11132.00

Back to shop

Proceed to Checkout

SVG

SVG

Search Products from 10 Million+

SVG

Bay 55-9837

SKU: BTL-IB-P-00062 | Brand: Isca Biochemical

Quick Enquiry

Product Description

Cat Number	VP-020
Category	Peptide
Pack Size	1 mg
Description	Selective VPAC2 agonist
Modification	C-terminal amide
Purity	>95% by hplc
Biomarker Target	Vasoactive intestinal peptide (VIP) receptors
Sequence Three Letter Code	H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Val-Ala-Ala-Lys-Lys-Tyr-Leu-Gln-Ser-Ile-Lys-Asn-Lys-Arg-Tyr-NH2
Molecular Formula	C167H270N52O46
Sl Sequence	HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2
Solubility	Soluble to 2 mg/ml in water
Appearance	Freeze dried solid
Storage	Store dry, frozen and in the dark
References	Tsutsumi et al (2002) A potent and highly selective VPAC2 agonist enhances glucose-induced Ins release and glucose disposal: a potential therapy for type 2 diabetes. Diabetes 51 1453 PMID: 11978642Darsalia et al (2013)The specific VPAC2 agonist Bay 55-9837 increases neuronal damage and hemorrhagic transformation after stroke in type 2 diabetic rats. Neuropeptides 47(2) 133 PMID: 22981158Hadwen et al (2014) VPAC2 receptor agonist BAY 55-9837 increases SMN protein levels and moderates disease phenotype in severe spinal muscular atrophy mouse models. Orphanet J Rare Dis. 9 4 PMID: 24405637 Related areas All peptides >All VIP receptor modulators >All diabetes research categories >All neuroscience research categories >All endocrinology research categories >
Note	The product is for research use only

SVG

SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers